Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
B-cell translocation gene 2 (BTG2) is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.It participates in the modulation of cell cycle transition. It has the ability to repress the migration and invasion of osteosarcoma cells.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
B-cell translocation gene 2 (BTG2) belongs to the BTG/TOB gene family. It is also called as nerve growth factor (NGF)-inducible anti-proliferative protein PC3 and NGF-inducible protein TIS21. BTG2 encodes a 158 amino acid protein. This gene is located on the long arm of human chromosome 1.
Immunogen
Synthetic peptide directed towards the middle region of human BTG2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :