Anti-TFR2

Code: sab2102414-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptida...


 En savoir plus

Votre prix
$517.56 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.This gene is a member of the transferrin receptor-like family and encodes a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TFR2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVFT

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
clonepolyclonal
concentration0.5 mg - 1 mg/mL
formbuffered aqueous solution
Gene Informationhuman ... TFR2(7036)
mol wt89 kDa
Quality Level100
shipped inwet ice
species reactivityhuman, rat, mouse, rabbit
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9UP52
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.