Anti-DND1

Code: av41198-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-DND1 polyclonal antibody is used to tag dead end homolog 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohist...


 En savoir plus

Votre prix
$518.29 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-DND1 polyclonal antibody is used to tag dead end homolog 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of dead end homolog 1 proteins in germ-cell and germ cell-tumor development, especially at the level of miRNA mediated repression of mRNA transcription.

Biochem/physiol Actions

DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Dead end homolog 1 (zebrafish) is an RNA binding protein found in primordial germ cells during embryogenesis. DND1 is essential for germ cell survival. Dnd1 appears to have a critical role in germ-cell and germ cell-tumor development. Dnd1 acts, at least in part, by protecting certain mRNAs from micro-RNA (miRNA)-mediated repression.

Immunogen

Synthetic peptide directed towards the C terminal region of human DND1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES

Specificity

Anti-DND1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine dead end homolog 1 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DND1(373863)
mol wt39 kDa
NCBI accession no.NP_919225
Quality Level100
shipped inwet ice
species reactivitymouse, rat, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q8IYX4
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.