Anti-TBX5

Code: av33402-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit polyclonal anti-TBX5 antibody is used to tag T-box 5 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is u...


 En savoir plus

Votre prix
$459.05 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit polyclonal anti-TBX5 antibody is used to tag T-box 5 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of T-box transcription factor 5 in the specification of upper limb identity and heart development during embryogenesis.

Biochem/physiol Actions

TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

T-box genes encode transcription factors that regulate developmental processes. T-box transcription factor 5 (TBX5), a transcription factor expressed in the prospective hindlimb and forelimb territories and in a subpopulation of endocardial cells, is involved in the regulation of the specification of upper limb identity and heart development during embryogenesis. Defective TBX5 is linked with Holt-Oram syndrome, a condition associated with bone defects in the upper arms, wrists and/or hands and congenital heart defects.

Immunogen

Synthetic peptide directed towards the middle region of human TBX5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVS

Specificity

Rabbit polyclonal anti-TBX5 antibody reacts with canine, rat, chicken, human, and mouse T-box transcription factor 5 transcription factors.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TBX5(6910)
mol wt39 kDa
NCBI accession no.NP_000183
Quality Level100
shipped inwet ice
species reactivitydog, human, bovine, guinea pig, rabbit, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q99593-2
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.