Anti-HSPA1A

Code: av33096-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit polyclonal anti- HSPA1A antibody is used to tag plasma circulating 70 kDa heat shock protein for detection and quantitation by immunocytochemical and immun...


 En savoir plus

Votre prix
$538.48 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit polyclonal anti- HSPA1A antibody is used to tag plasma circulating 70 kDa heat shock protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of plasma circulating 70 kDa heat shock proteins in the activation of cells containing TLR2 and TLR4 receptors, the stimulation of proinflammatory immune responses and the development of atherosclerosis.

Biochem/physiol Actions

HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Heat shock 70 kDa protein 1A (HSPA1A, eHSP70, HSP72) is an environmental stress-inducible extracellular/plasma circulating heat shock protein that interacts with effector cells of the innate immune system. HSPA1A promotes the proliferation of H22 hepatocarcinoma cells through TLR2 and TLR4 signaling. HSPAIA signaling via TLR4 may trigger O3-induced lung inflammation. HSPA1A and its in vivo antibodies may contribute to the development of atherosclerosis. HSPA1A may stimulate innate and adaptive proinflammatory immune responses.

Immunogen

Synthetic peptide directed towards the middle region of human HSPA1A

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Specificity

Rabbit polyclonal anti- HSPA1A antibody reacts with zebrafish, human, mouse, rat, Caenorhabditis elegans, and canine plasma circulating 70 kDa heat shock proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HSPA1A(3303)
mol wt52 kDa
NCBI accession no.NP_005337
Quality Level100
shipped inwet ice
species reactivitygoat, guinea pig, mouse, rabbit, sheep, human, dog, bovine, horse, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P08107
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.