Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit polyclonal anti-MyEF2 antibody is used to tag myelin expression factor 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of myelin expression factor 2 in the repression of genes involved in myelinogenesis and hematopoiesis.
Rabbit Anti-MyEF2 can be used for western blot (1 µg/ml) and IHC (4-8 µg/ml) applications.
Biochem/physiol Actions
MEF-2 is expressed early in the differentiation program and is suppressed by specific polypeptide growth factors. The ability of MEF-2 to recognize conserved activating elements associated with multiple-specific genes suggests that this factor may participate in the coordinate regulation of genes during myogenesis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Myelin basic protein (MBP) is a major component of the myelin sheath whose production is developmentally controlled during myelinogenesis. Myelin expression factor 2 (MyEF2), a single-stranded DNA binding factor, is a repressor of myelin basic protein (MBP) expression. MyEF2 interacts with RUNX1 to represses hematopoietic genes in erythroid cells.
Rabbit polyclonal anti-MyEF2 antibody reacts with bovine, canine, human, mouse, rat, zebrafish, and chicken myelin expression factor 2 proteins.
Immunogen
Synthetic peptide directed towards the middle region of human MYEF2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :