Anti-MTF1

Code: av32027-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-MTF1 antibody can be used for western blot applications at a concentration of 5.0µg/ml.

Biochem/physiol Actions

The ...


 En savoir plus

Votre prix
$456.19 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-MTF1 antibody can be used for western blot applications at a concentration of 5.0µg/ml.

Biochem/physiol Actions

The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Metal-response element-binding transcription factor 1 (MTF1) is a cellular zinc sensor that is involved in zinc homeostasis. MTF1 is also known to protect against oxidative stress and metal toxicity. Furthermore, MTF1 can modulate metallothionein gene expression.Rabbit Anti-MTF1 antibody recognizes human, mouse, rat, bovine, and canine MTF1.

Immunogen

Synthetic peptide directed towards the C terminal region of human MTF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPG

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MTF1(4520)
mol wt81 kDa
NCBI accession no.NP_005946
Quality Level100
shipped inwet ice
species reactivitymouse, horse, dog, bovine, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q14872
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.