Anti-CDX2

Code: av31476-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-CDX2 antibody can be used for western blot assays at a concentration of 0.5µg/ml.

Biochem/physiol Actions

CDX2 encod...


 En savoir plus

Votre prix
$610.31 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-CDX2 antibody can be used for western blot assays at a concentration of 0.5µg/ml.

Biochem/physiol Actions

CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett′s esophagus.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Cdx2 is a homeobox gene that regulates trophectoderm differentiation and cell fate decisions in mouse blastocysts. CDX2 expression has also been linked to intestinal metaplasia and gastric carcinogenesis.Rabbit Anti-CDX2 antibody recognizes canine, chicken, human, mouse, rat, and pig CDX2.

Immunogen

Synthetic peptide directed towards the middle region of human CDX2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CDX2(1045)
mol wt34 kDa
NCBI accession no.NP_001256
Quality Level100
shipped inwet ice
species reactivitydog, rat, rabbit, guinea pig, mouse, human, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q99626
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.