ANTI-SUR2A - PERCP MONOCLONAL

Code: SAB5200939-100UG D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 En savoir plus

Votre prix
$697.33 100UG

Non disponible en dehors du Royaume-Uni et de l'Irlande

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Immunogen

Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Physical form

PBS pH7.4, 50% glycerol, 0.09% sodium azide

antibody formpurified immunoglobulin
antibody product typeprimary antibodies
biological sourcemouse
cloneS319A-14, monoclonal
concentration1 mg/mL
conjugatePeridinin-Chlorophyll-Protein Complex
formbuffered aqueous solution
Gene Informationmouse ... Abcc9(20928)
isotypeIgG2a
mol wtantigen predicted mol wt 120 kDa
NCBI accession no.NP_001038185.1
Quality Level100
shipped inwet ice
species reactivityrat, mouse
storage temp.−20°C
technique(s)immunocytochemistry: suitable, western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q63563
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.