Anti-SIRT3

Code: AV32388-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-SIRT3 (AB2) antibody can be used for western blot applications at a concentration of 2.5µg/ml.

Biochem/physiol Actions

...


 En savoir plus

Votre prix
$455.72 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-SIRT3 (AB2) antibody can be used for western blot applications at a concentration of 2.5µg/ml.

Biochem/physiol Actions

SIRT3 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SIRT3 is a mitochondrial sirtuin deacetylase that modulates thermogenesis in brown fat cells. Studies have also reported that SIRT3 regulates the acetylation of mitochondrial lysine.Rabbit Anti-SIRT3 (AB2) antibody recognizes zebrafish, rabbit, human, rat, canine, and mouse SIRT3.

Immunogen

Synthetic peptide directed towards the middle region of human SIRT3

Sequence

Synthetic peptide located within the following region: SGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SIRT3(23410)
mol wt44 kDa
NCBI accession no.NP_001017524
Quality Level100
shipped inwet ice
species reactivityhorse, human, mouse, rat, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NTG7
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.