SILU(TM)LITE CST3

Code: msst0060-50ug D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Me...


 Read more

Your Price
$825.22 50UG

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

General description

SILuLite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILuLite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Physical form

Supplied as a lyophilized powder containing tris buffered saline and methionine.

Sequence

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

assay≥95% (SDS-PAGE)
formlyophilized powder
Gene Informationhuman ... CST3(1471)
Quality Level200
recombinantexpressed in E. coli
shipped inambient
storage temp.−20°C
suitabilitysuitable for mass spectrometry (internal calibrator)
UniProt accession no.P01034 (aa 27-146)
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.