Protéine d'échafaudage de Membrane 1D1, recombinante, exprimée en E. coli

Code: m6574-5mg D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

For guidelines on the use of this and other MSP′s to prepare Nanodiscs, please visit our Protocols for Membrane Scaffold Proteins and Nanodisc Formation pag...


 En savoir plus

Votre prix
$683.17 5MG
Abandonné

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

For guidelines on the use of this and other MSP′s to prepare Nanodiscs, please visit our Protocols for Membrane Scaffold Proteins and Nanodisc Formation page.

Membrane Scaffold Protein 1D1 has been used as a scaffoldingprotein to stabilize lipid nanodiscs (NDs). It has also been used for the preparation of nanodiscs.

The nanodisc system has been employed to incorporate a wide variety of proteins including GPCRs, P450s, bacteriorhodopsin, coagulation factors, cholera toxin, TAR receptor and aromatase.

Nanodisc soluble lipid bilayer systems have proven to be a widely applicable means for rendering membrane proteins soluble in aqueous solutions in a native-like bilayer environment where they remain monodisperse and active. The critical component of nanodiscs is the encircling amphipathic helical protein belt (membrane scaffold protein).

Biochem/physiol Actions

Generates Nanodiscs ~9.7 nm in diameter

Membrane scaffold protein 1D1 (MSP1D1) is derived from apolipoprotein A-I. It is an amphipathic synthetic protein, which self assembles to form nanodiscs.

Legal Information

Nanodisc technology, and many of its uses, are covered by the following patents held by the University of Illinois. 7,691,414 Membrane scaffold proteins 7,662,410 Membrane scaffold proteins and embedded membrane proteins 7,622,437 Tissue factor compositions and methods 7,592,008 Membrane scaffold proteins 7,575,763 Membrane scaffold proteins and tethered membrane proteins 7,083,958 Membrane scaffold proteins 7,048,949 Membrane scaffold proteins

Physical form

Supplied as a lyophilized histidine-tagged protein with a TEV protease cleavage site stabilized with Tris-HCl, EDTA, and NaCl.

Physical properties

Sequence:GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

ε (extinction coefficient)18200 M-1cm-1 at 280 nm (for the His-tag-cleaved form dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.), 21000 M-1cm-1 at 280 nm (for the uncleaved His-tagged form dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)
biological sourcemicrobial
descriptionN-Terminal histidine-tagged
formlyophilized powder
mol wtMw 24661.9 by amino acid sequence
Quality Level200
recombinantexpressed in E. coli
storage temp.−20°C
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.