ANTI-P2RY1 (N-TERMINAL) ANTIBODY PRODUC

Code: sab2109077-100ul D2-231

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 Read more

Your Price
$493.36 100UL

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. [provided by RefSeq, Jul 2008].

Immunogen

Synthetic peptide directed towards the N terminal region of human P2RY1

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... P2RY1(57396)
mol wt42 kDa
NCBI accession no.NM_002563.2
shipped inwet ice
species reactivity (predicted by homology)guinea pig, human, rat, mouse, canine, bovine, rabbit, horse
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.