Anti-TBX15

Code: av47723-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit anti-TBX15 antibody is suitable for western blot applications at a concentration of 1.25µg/ml and for IHC applications (using paraffin-embedded tissue...


 En savoir plus

Votre prix
$456.36 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit anti-TBX15 antibody is suitable for western blot applications at a concentration of 1.25µg/ml and for IHC applications (using paraffin-embedded tissues) at 4-8µg/ml.

Biochem/physiol Actions

TBX15 is a probable transcriptional regulator involved in developmental processes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

TBX15 codes for T-box transcription factor that regulates embryonic development. TBX15 mutations have been linked to Cousin syndrome.Rabbit anti-TBX15 antibody recognizes human, mouse, rat, and canine TBX15.

Immunogen

Synthetic peptide directed towards the C terminal region of human TBX15

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMH

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TBX15(6913)
mol wt55 kDa
NCBI accession no.NP_689593
Quality Level100
shipped inwet ice
species reactivityrat, dog, human, bovine, guinea pig, mouse, horse, rabbit
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q5JT54
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.