Anti-COBLL1

Code: av42423-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-COBLL1 polyclonal antibody is used to tag COBL-like 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochem...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-COBLL1 polyclonal antibody is used to tag COBL-like 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a prognostic indicator for malignant pleural mesothelioma.

Biochem/physiol Actions

The function remains known.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

COBLL1, a negative regulator of apoptosis in cultured tumor cells, has been identified as a component of a robust predictive four gene ratio test for survival of patients with malignant pleural mesothelioma.

Immunogen

Synthetic peptide directed towards the N terminal region of human COBLL1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS

Specificity

Anti-COBLL1 polyclonal antibody reacts with human, mouse, rat, and canine COBL-like 1 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... COBLL1(22837)
mol wt128 kDa
NCBI accession no.NP_055715
Quality Level100
shipped inwet ice
species reactivitybovine, horse, rabbit, human, mouse, guinea pig, dog, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.A6NMZ3
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.