Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
KEAP1 (Kelch-like ECH-associated protein 1) is an adaptor protein that represses Nrf2-mediated transcription. The KEAP1/Nrf2 axis regulates the ROS signaling and has important role in osteoclast differentiation and expression of antioxidant enzymes. Aberrant methylation of KEAP1 gene has been reported in breast cancer and may contribute to the cancer progression.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human KEAP1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :