Anti-POU2F3

Code: av32537-100ul D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-POU2F3 antibody can be used for western blotting applications at a concentration of 0.5µg/ml. It can also be used for IHC assays at 4-8µg/ml...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-POU2F3 antibody can be used for western blotting applications at a concentration of 0.5µg/ml. It can also be used for IHC assays at 4-8µg/ml, using paraffin-embedded tissues.

Biochem/physiol Actions

POU2F3 is a transcription factor that is involved in the growth and differentiation of keratinocytes. Studies have reported that Pou2f3 (Skn-1a) is involved in the differentiation of chemosensory cells. Furthermore, this transcription factor is also required for specifying the lineage of taste receptor cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

POU2F3, also known as Skn-1a and OCT11, gene is mapped to human chromosome 11q23.3. The gene codes for a keratinocyte-specific POU transcription factor. The protein is expressed in stratified squamous epithelia, including the epidermis, cervix and foreskin.

Immunogen

Synthetic peptide directed towards the N terminal region of human POU2F3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... POU2F3(25833)
mol wt47 kDa
NCBI accession no.NP_055167
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, mouse, human, guinea pig, dog, sheep
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9UKI9
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.