Not available outside of the UK & Ireland.
Biochem/physiol Actions
Slc16a3 is a proton-linked monocarboxylate transporter. It catalyses the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT4 is upregulated in the hypoxic environment in glioblastoma, and is implicated in solid tumours like breast cancer and bladder cancer and leads to metastasis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Solute carrier family 16 member 3 (SLC16A3) encodes monocarboxylate transporter 4 (MCT4). MCT4 is targeted by the chaperone CD147 to the basolateral plasma membrane. MCT4 is highly expressed in astrocytes, skeletal muscle fibres, chondrocytes, placenta. In human chromosome, the gene SLC16A3 is located on 17q25.3.
Immunogen
Synthetic peptide directed towards the N terminal of human SLC16A3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRP
This product has met the following criteria to qualify for the following awards: