ANTI-SLC16A3

Code: SAB2108408-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Slc16a3 is a proton-linked monocarboxylate transporter. It catalyses the rapid transport across the plasma membrane of many monocarboxylates such as l...


 Read more

Your Price
$510.21 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Slc16a3 is a proton-linked monocarboxylate transporter. It catalyses the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT4 is upregulated in the hypoxic environment in glioblastoma, and is implicated in solid tumours like breast cancer and bladder cancer and leads to metastasis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Solute carrier family 16 member 3 (SLC16A3) encodes monocarboxylate transporter 4 (MCT4). MCT4 is targeted by the chaperone CD147 to the basolateral plasma membrane. MCT4 is highly expressed in astrocytes, skeletal muscle fibres, chondrocytes, placenta. In human chromosome, the gene SLC16A3 is located on 17q25.3.

Immunogen

Synthetic peptide directed towards the N terminal of human SLC16A3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC16A3(9123)
mol wt50kDa
NCBI accession no.NM_030696
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.P57787
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.