Anti-PNCK

Code: sab2106946-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Pnck is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro, Pnck phosphorylates CREB1...


 En savoir plus

Votre prix
$599.56 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

Pnck is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro, Pnck phosphorylates CREB1 and SYN1/synapsin I and phosphorylates and activates CAMK1.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

The immunogen for anti-PNCK antibody: synthetic peptide derected towards the C terminal of human PNCK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PNCK(139728)mouse ... Pnck(93843)
mol wt38 kDa
NCBI accession no.NM_012040
Quality Level100
shipped inwet ice
species reactivityrabbit, human, rat, dog, pig, bovine, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9QYK9
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.