Anti-SLC24A6

Code: sab2102181-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-SLC24A6 antibody produced in rabbit has been used in western blotting(1:250).

Biochem/physiol Actions

Solute carrier family 8, m...


 En savoir plus

Votre prix
$612.52 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-SLC24A6 antibody produced in rabbit has been used in western blotting(1:250).

Biochem/physiol Actions

Solute carrier family 8, member B1 (SLC8B1)/Na+/Ca2+/Li+ exchanger (NCLX) helps in the transportation of the sodium or lithium-ion in exchange for the calcium ion.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Solute carrier family 24, member 6 (SLC24A6) or solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 (SLC8B1) gene codes for Na+/Ca2+/Li+ exchanger (NCLX).NCLX belongs to the Na+/Ca2+ exchanger (NCX) family. This protein is expressed at a high level in the brain, skeletal and heart muscle, pancreas β-cells, and lymphocyte B-cells. NCLX contains a small regulatory domain that has a phosphorylation site and lacks Ca2+ binding domains (CBDs).

Immunogen

Synthetic peptide directed towards the middle region of human SLC24A6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC24A6(80024)
mol wt64 kDa
Quality Level100
shipped inwet ice
species reactivityhuman, horse, rat, dog, guinea pig, bovine, mouse, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q6J4K2
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.