Not available outside of the UK & Ireland.
Application
Anti-GP1BA antibody produced in rabbit is suitable for western blotting at a concentration of 0.25µg/ml.
Biochem/physiol Actions
Glycoprotein Ib (GP1BA) is a membrane glycoprotein present on the surface of platelets. It acts as the receptors for von Willebrand factor that facilitates the adhesion of platelets to vascular subendothelium after vascular injury, thrombosis, platelet activation and hemostasis. Mutations in GP1BA are associated with Bernard-Soulier syndromes and platelet-type von Willebrand disease.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human GP1BA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
This product has met the following criteria to qualify for the following awards: