Anti-SDF2

Code: AV48718-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SDF2 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml and for IHC at 4-8 µg/ml.

Biochem/phy...


 Read more

Your Price
$538.48 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SDF2 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml and for IHC at 4-8 µg/ml.

Biochem/physiol Actions

SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SDF2 codes for stromal cell-derived factor 2 that functions as a secretory protein. Studies in Arabidopsis have revealed that SDF2 regulates unfolded protein response in the endoplasmic reticulum.Rabbit Anti-SDF2 antibody recognizes bovine, human, mouse, rat, and zebrafish SDF2.

Immunogen

Synthetic peptide directed towards the N terminal region of human SDF2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SDF2(6388)
mol wt21 kDa
NCBI accession no.NP_008854
Quality Level100
shipped inwet ice
species reactivitymouse, rabbit, guinea pig, bovine, horse, rat, human, dog
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q99470
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.