Anti-RTN2

Code: AV46626-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-RTN2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/mL. It is also useful for immunohistochemistry at a concen...


 Read more

Your Price
$538.48 100UL

Not available outside of the UK & Ireland.

Application

Anti-RTN2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/mL. It is also useful for immunohistochemistry at a concentration of 4-8µg/mL.

Biochem/physiol Actions

RTN2 (reticulon 2) gene also referred to as NSP2 or NSPL1 is a member of reticulon encoding gene family. It plays a pivotal role in organizing endoplasmic reticulum and distal motor axons. RTN2B, isoform of RTN2 regulates the trafficking as well as facilitates as a positive modulator for delivering the EAAC1 (excitatory amino acid carrier 1) from ER to the cell surface. Mutation in RTN2 gene leads to axon-degenerative disorder hereditary spastic paraplegia type 12.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human RTN2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RTN2(6253)
mol wt51 kDa
NCBI accession no.NP_996783
Quality Level100
shipped inwet ice
species reactivitymouse, pig, bovine, human, rat, dog, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.A8K7F2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.