Anti-USP48

Not available outside of the UK & Ireland.

Application

Anti-USP48 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Ubiquitin specific peptidase 48 (USP48; USP31) is a deubiquitinating enzyme that belongs to C19 peptidase family. It recognizes and hydrolyzes the peptide bond of ubiquitin at the C-terminal glycine. USP48 reportedly interacts with p65/RelA subunits of NF-κB and regulates its activation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human USP48

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS