Not available outside of the UK & Ireland.
Application
Anti-PLD3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.
Biochem/physiol Actions
Phospholipase D (PLD) family, member 3 belongs to the PLD family of enzymes that hydrolyze the membrane phospholipids. PLD3 is associated with the endoplasmic reticulum and is expressed in a variety of tissues and cells. The expression of PLD3 increases drastically in neurons and muscle cells during differentiation. PLD3 is involved in the processing of amyloid-beta precursor protein and myogenesis during the formation of the myotube.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human PLD3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
This product has met the following criteria to qualify for the following awards: