Not available outside of the UK & Ireland.
Application
Anti-DND1 polyclonal antibody is used to tag dead end homolog 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of dead end homolog 1 proteins in germ-cell and germ cell-tumor development, especially at the level of miRNA mediated repression of mRNA transcription.
Biochem/physiol Actions
DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Dead end homolog 1 (zebrafish) is an RNA binding protein found in primordial germ cells during embryogenesis. DND1 is essential for germ cell survival. Dnd1 appears to have a critical role in germ-cell and germ cell-tumor development. Dnd1 acts, at least in part, by protecting certain mRNAs from micro-RNA (miRNA)-mediated repression.
Immunogen
Synthetic peptide directed towards the C terminal region of human DND1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
Specificity
Anti-DND1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine dead end homolog 1 proteins.
This product has met the following criteria to qualify for the following awards: