Not available outside of the UK & Ireland.
Biochem/physiol Actions
ZFP36L2 is a member of TIS11 family and contains a putative zinc finger domain with a repeating cys-his motif. It is an RNA-binding protein and binds to mRNA molecules that are highly expressed for self-renewal of erythroid progenitors and terminal erythroid differentiation. ZFP36L2 is required thymic development and prevention of malignant transformation of T cells.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZFP36L2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAP
This product has met the following criteria to qualify for the following awards: