Anti-SMAD1

Not available outside of the UK & Ireland.

Biochem/physiol Actions

SMAD proteins are transcription regulators that mediate multiple signal transduction pathways. They are involved in a wide variety of cellular processes such as cell growth, apoptosis, survival, differentiation, morphogenesis and immune responses. SMAD1 interacts with PAWS1/FAM83G protein and regulates bone morphogenetic protein signaling.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SMAD1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEE