Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
NFATC2 is a member of The NF-AT family of potent transcription factors that are essential for T cell activation
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Nuclear factor of activated T-cells, cytoplasmic 2(NFATC2) is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). Upon T cell receptor (TCR) stimulation, NFATC2 gets translocated from the cytoskeleton to the nucleus where it becomes a component of the the nuclear factors of activated T cells transcription complex. It plays a role in regulating expression of genes critical for cell cycle progression during lymphocyte activation.
Immunogen
Synthetic peptide directed towards the N terminal region of mouse NFATC2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :