Anti-SIAH1

Code: AV34163-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SIAH1 (AB1) antibody can be used for western blot applications at 1.25 µg/ml.

Biochem/physiol Actions

SIAH1 is a pro...


 Read more

Your Price
$480.59 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SIAH1 (AB1) antibody can be used for western blot applications at 1.25 µg/ml.

Biochem/physiol Actions

SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson′s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SIAH1 is an E3 ligase that regulates protein ubiquitination and proteasome-mediated degradation. Studies have reported that the N-terminal RING domain regulates proteolysis, whereas the C-terminal sequences modulate target protein binding activities. It has also been implicated in p53 response-mediated degradation of β-catenin.Rabbit Anti-SIAH1 (AB1) antibody recognizes bovine, human, mouse, rat, canine, and zebrafish SIAH1.

Immunogen

Synthetic peptide directed towards the N terminal region of human SIAH1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SIAH1(6477)
mol wt35 kDa
NCBI accession no.NP_001006611
Quality Level100
shipped inwet ice
species reactivitybovine, rat, mouse, rabbit, guinea pig, human, horse, dog
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q8IUQ4-2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.