Anti-E2F4

Code: AV31175-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-E2F4 antibody can be used for western blot (2.0µg/ml) and IHC (4-8µg/ml) applications.

Biochem/physiol Actions

...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-E2F4 antibody can be used for western blot (2.0µg/ml) and IHC (4-8µg/ml) applications.

Biochem/physiol Actions

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins. It is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It also plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human E2F4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... E2F4(1874)
mol wt44 kDa
NCBI accession no.NP_001941
Quality Level100
shipped inwet ice
species reactivitymouse, horse, guinea pig, dog, human, rat, bovine, rabbit
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: 4-8 µg/mL (Paraffin-embedded Tissue)
UniProt accession no.Q16254
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.