Anti-SMAD3

Code: AV100621-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-SMAD3 antibody produced in rabbit is suitable for western blotting at a concentration of 2 µg/ml. For immunohistochemistry of paraffin-embedded tissue s...


 Read more

Your Price
$417.32 100UL

Not available outside of the UK & Ireland.

Application

Anti-SMAD3 antibody produced in rabbit is suitable for western blotting at a concentration of 2 µg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 µg/ml is suitable.

Biochem/physiol Actions

Smad3 is phosphorylated by TGF-b, heterodimerizes with Smad4 and enters the nucleus. The heterodimer binds within the promoter of plasminogen activator inhibitor-1 (PAI-1) and induces its expression.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The members of Smad family of proteins are essential intracellular mediators of TGF-β signaling.

Immunogen

Synthetic peptide directed towards the N terminal region of human SMAD3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
application(s)research pathology
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SMAD3(4088)
mol wt48 kDa
NCBI accession no.NP_005893
Quality Level100
shipped inwet ice
species reactivitymouse, guinea pig, rat, dog, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P84022
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.