Not available outside of the UK & Ireland.
Application
Anti-CDK2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 µg/ml is suitable.
Biochem/physiol Actions
Cyclin-dependent kinase 2 has a unique role in suppressing cell senescence and apoptosis induced by Myc. It is redundant for cell cycle progression but is activated following Myc overexpression to prevent Myc-induced senescence-like arrest. CDK2 functions in association with cyclin E and regulates meiosis at prophase I.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human CDK2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
This product has met the following criteria to qualify for the following awards: