Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-SPNS2, (N-terminal) antibody produced in rabbit has been used in immunoblotting (1:1000)/(1:3,000).
Biochem/physiol Actions
The sphingolipid transporter 2/Spinster 2 (SPNS2) protein serves as a mediator to release intracellular sphingosine-1-phosphate (S1P) and thereby regulates S1P. It might play a role in embryogenesis. Members of MFS family regulates the homeostasis in the body by transporting sugars, amino acids, ions, intermediary metabolites, and other small molecules across membranes. Lack of SPNS2 results in a significant reduction in S1P plasma levels. It plays an important role in prostate cancer, inflammatory and autoimmune diseases, and liver fibrosis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
The sphingolipid transporter 2/Spinster 2 (SPNS2) gene codes for a transporter of the sphingosine-1-phosphate (S1P) signaling lipid. SPNS2 is a multi-pass transmembrane protein, that belongs to the spinster (SPNS)/major facilitator superfamily (MFS) family. It has 12 transmembrane domains. SPNS2 mRNA is seen abundantly in the lung, stomach, and placenta. It is expressed at a moderate level in the cervix, small intestine, brain, skin,lymph node, and other tissues.
Immunogen
Synthetic peptide directed towards the N terminal region of human SPNS2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :