Anti-RORA

Code: AV45608-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-RORA (AB3) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml and for immunohistochemistry of paraffin-embedde...


 En savoir plus

Votre prix
$399.82 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-RORA (AB3) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8µg/ml.

Biochem/physiol Actions

Retinoic acid related orphan receptor A (RORA), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORA is widely expressed and enhances p53-dependent apoptosis. RORA is important for the development of the cerebellum and it is required for the maturation of photoreceptors in the retina.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human RORA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... RORA(6095)
mol wt63 kDa
NCBI accession no.NP_599022
Quality Level100
shipped inwet ice
species reactivityhorse, human, bovine, dog, rat, guinea pig, goat, rabbit, sheep, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P35398
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.